PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa02g069890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family LFY
Protein Properties Length: 429aa    MW: 47242.9 Da    PI: 6.7862
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa02g069890.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY608.81.1e-18513961386
         FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslse 95 
                     mdpe f++ lf+w+p  a++++p+ + +  +++ +p + ++aa  ++l +le lf ayG+r++t+akiaelGft+stLv+m+deel+++m+sls+
  Csa02g069890.1   1 MDPEGFTSGLFRWNPTRAMVPAPSPVPPPLQQQ-PP-TPQTAAFGMRLGGLEGLFGAYGIRFYTAAKIAELGFTASTLVGMRDEELEEMMNSLSH 93 
                     9*************9999989888887666544.44.466777788889********************************************** PP

         FLO_LFY  96 ifrldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqe....glseepvqeekeaagsggeglgeaelvaaeek 179
                     ifr++llvGeryGikaavraerrrl+e  ee++++rr+ll      + +++aldalsqe    glseepvq++ ++ ++g++g g +e+ + + k
  Csa02g069890.1  94 IFRWELLVGERYGIKAAVRAERRRLQEeeEEESSRRRHLLltaagDSGTHHALDALSQEddwtGLSEEPVQQQDQTDAAGNNG-GYWEAGQGKMK 187
                     *************************99544456778887778844344556*******988889******9977766665555.67776655422 PP

         FLO_LFY 180 kseeekkkaskkkqkrkkkkelkseededeeeeededeeg..........sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLl 264
                            k +  +++rkk   ++ e+d+d +e ed+d+++          sg  g+erqrehPfivtepgevargkknGLDYLf+LyeqCrefLl
  Csa02g069890.1 188 -------KLQP-QRRRKKPMVASVETDDDGNEGEDDDGMDngnggvgggsSGGLGTERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCREFLL 274
                     .......2222.22223332223334444444444333333344555444566677*************************************** PP

         FLO_LFY 265 qvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavf 359
                     qvq+iak+rGekcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvG+wrqacykplv+ia r+gwdidavf
  Csa02g069890.1 275 QVQTIAKDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGSWRQACYKPLVNIACRHGWDIDAVF 369
                     *********************************************************************************************** PP

         FLO_LFY 360 nahprLsiWYvPtkLrqLChlerskas 386
                     nahprLsiWYvPtkLrqLChler++a+
  Csa02g069890.1 370 NAHPRLSIWYVPTKLRQLCHLERNNAA 396
                     ************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.9E-1961396IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRAMV PAPSPVPPPL QQQPPTPQTA AFGMRLGGLE GLFGAYGIRF  60
YTAAKIAELG FTASTLVGMR DEELEEMMNS LSHIFRWELL VGERYGIKAA VRAERRRLQE  120
EEEEESSRRR HLLLTAAGDS GTHHALDALS QEDDWTGLSE EPVQQQDQTD AAGNNGGYWE  180
AGQGKMKKLQ PQRRRKKPMV ASVETDDDGN EGEDDDGMDN GNGGVGGGSS GGLGTERQRE  240
HPFIVTEPGE VARGKKNGLD YLFHLYEQCR EFLLQVQTIA KDRGEKCPTK VTNQVFRYAK  300
KSGASYINKP KMRHYVHCYA LHCLDEEASN ALRRAFKERG ENVGSWRQAC YKPLVNIACR  360
HGWDIDAVFN AHPRLSIWYV PTKLRQLCHL ERNNAAAAAA AAALVGGISC TGSSTSGRGG  420
CGGDELRF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1372334281194PROTEIN LEAFY
2vy2_A1e-1372334281194PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4719320.0DQ471932.1 Brassica juncea cultivar Varuna LEAFY transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010457875.10.0PREDICTED: protein LEAFY isoform X1
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLQ6XPU70.0Q6XPU7_LEACR; LEAFY-like protein
STRINGAT5G61850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)